PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G125600.1
Common NameB456_002G125600, LOC105784785
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SRS
Protein Properties Length: 308aa    MW: 34165.9 Da    PI: 6.9172
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G125600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702232.85.8e-72912412154
              DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstkls 92 
                         ++g+++CqdCGnqakkdCah+RCRtCCksrgf+C+thvkstWvpaakrrerqqqlaa++++++++ +   ++ kr  +++ + +l++t+ls
  Gorai.002G125600.1  91 KHGGMNCQDCGNQAKKDCAHMRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQLAALQHHQQHEDQFRGENPKRLRENQGSPSLACTRLS 181
                         6899******************************************************999998885555555555556888899999999 PP

              DUF702  93 saeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                          ++s   le  ++P+evss+avfrcv+vs++dd++ee+aYqtav+i+GhvfkGiLydqG+e+
  Gorai.002G125600.1 182 PTTSG--LELGQFPPEVSSPAVFRCVKVSAMDDEDEEFAYQTAVNIAGHVFKGILYDQGPES 241
                         88765..88899************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.0E-6894240IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.1E-2796138IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016249.9E-27191239IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048467Biological Processgynoecium development
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MAGLFYLGGR EADTGNKQEE DKEESLYLYR NEEIYNKGFE IWPQYYYQQQ QQQQQENVNT  60
ISFGAGPSRR ARGFNLSDEP SSRSVGFTVM KHGGMNCQDC GNQAKKDCAH MRCRTCCKSR  120
GFQCQTHVKS TWVPAAKRRE RQQQLAALQH HQQHEDQFRG ENPKRLRENQ GSPSLACTRL  180
SPTTSGLELG QFPPEVSSPA VFRCVKVSAM DDEDEEFAYQ TAVNIAGHVF KGILYDQGPE  240
SHYTGGGESS QQLNLITAAV TTAETARTTT TAAISSNPAT SMLDPSLYPA PLNAFIAGTQ  300
FFPPPRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6162870.0JX616287.1 Gossypium hirsutum clone NBRI_GE60826 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012466169.10.0PREDICTED: protein SHI RELATED SEQUENCE 5-like
SwissprotQ9LQZ51e-104SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLA0A0D2QC220.0A0A0D2QC22_G
STRINGPOPTR_0002s03000.11e-116(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.12e-91SHI-related sequence 5
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]